Post not yet marked as solved
how we can implement music kit in flutter app?
Post not yet marked as solved
SwiftData includes support for CloudKit sync. However, I don't see any way to add conflict resolution behavior. For example, if different devices set different values for a field, or if a relationship is orphaned because of a deletion on another device, the application has to handle this somehow.
In Core Data (which SwiftData wraps), you can handle this with the conflict resolution system (docs) and classes like NSMergePolicy.
Is any of this accessible in SwiftData? If not, how do you deal with conflicts when syncing a SwiftData model with the cloud?
Post not yet marked as solved
Recently, I have made quite extensive changes to my schema and need to migrate my CoreData + CloudKit model to a new version. The changes require me to use a custom NSEntityMigrationPolicy because I have a rather complex mapping between some old entities and new entities.
I have added a new model version. Deleted some entities, and added some entities.
I have defined the NSEntityMigrationPolicy with createDestinationInstances(forSource:in:manager:) and createRelationships(forDestination:in:manager:).
I have created a new Core Data Mapping Model. This was probably unnecessary.
Within the Core Data Mapping Model, I have specified Custom Policy for all entities.
In my container setup, I added two options, as below:
storeDescription.setOption(false as NSNumber, forKey: NSMigratePersistentStoresAutomaticallyOption)
storeDescription.setOption(false as NSNumber, forKey: NSInferMappingModelAutomaticallyOption)
I mostly followed a "Core Data Heavyweight Migration" guide. I'm unable to share the link, but it can be quite easily found on the web. (It's not for CloudKit specifically.)
When I run my app, I am getting the most basic of errors, which is:
The managed object model version used to open the persistent store is incompatible with the one that was used to create the persistent store.
So I guess that migration wasn't even attempted, which makes sense because I set NSMigratePersistentStoresAutomaticallyOption to false.
I tried to go beyond what I could find on the web and attempted to manually initialize migration:
let sourceModel = container.persistentStoreCoordinator.managedObjectModel
guard let modelURL = Bundle.main.url(forResource: "MyModelName", withExtension: "xcdatamodeld") else {
fatalError("Unable to locate model file.")
}
guard let destinationModel = NSManagedObjectModel(contentsOf: modelURL) else {
fatalError("Unable to load destination model.")
}
let migrationManager = NSMigrationManager(sourceModel: sourceModel, destinationModel: destinationModel)
let mappingModel = NSMappingModel(from: [Bundle.main], forSourceModel: sourceModel, destinationModel: destinationModel)!
migrationManager.currentEntityMapping.entityMigrationPolicyClassName = "MyMigrationPolicyClassName"
I am then stuck at the migrateStore(from:type:mapping:to:type:) method. It seems to target only local storage, not CloudKit. Otherwise, what do I provide for URLs and types?
Any guidance for custom logic CoreData with CloudKit migration would be greatly appreciated.
Post not yet marked as solved
I ran it (Leaks) on a process for about 2 hours. It collected 68gytes of data. It cannot open the folder -- can't find a file (which is there as a .zip archive) or if I expand it, just an error about missing an index.
Filing a bug about this is difficult, since it's 68gbyets of data.
Post not yet marked as solved
Hello, we have a pkg file which used to be easily notarized using a particular apple id, but after we shifted to another account it is taking like forever.
We have created an app-specific-password and made use of it. Anything that we have done incorrectly?
Current status: In Progress........................................................[12:12:27.335Z] Info [API] Waiting 20 seconds before next poll...
[12:12:47.337Z] Info [API] Preparing GET request to URL: https://appstoreconnect.apple.com/notary/v2/submissions/***-xxxxxx?, Parameters: [:], Custom Headers: private<Dictionary<String, String>>
[12:12:47.338Z] Debug [AUTHENTICATION] Using cached token value for app-specific password request: xxxxx:xxxxx@***
[12:12:47.338Z] Debug [AUTHENTICATION] Authenticating request to '/notary/v2/submissions/***-xxxxxx' with WebServices Token. AppleID: xxxx@***, Team ID: xxxxxxxxxx, Token: private<String>
[12:12:47.339Z] Debug [TASKMANAGER] Starting Task Manager loop to wait for asynchronous HTTP calls.
[12:12:47.886Z] Debug [API] Received response status code: 200, message: no error, URL: https://appstoreconnect.apple.com/notary/v2/submissions/***-xxxxxx?, Correlation Key: GBCZEFTI5NQ3263GKRANCEPD4I
[12:12:47.887Z] Debug [TASKMANAGER] Completed Task with ID 58 has received a parsable response.
[12:12:47.887Z] Debug [TASKMANAGER] Ending Task Manager loop.
[12:12:47.888Z] Info [API] Received new status: In Progress
Post not yet marked as solved
Hey there,
I'm trying to decode an json with an dynamic dict as value.
eg.
"results": [
{
"id": 1799,
"created_at": "2024-05-09T14:21:13.289655Z",
"updated_at": "2024-05-10T11:54:25.484537Z",
"email": "test@test.testh",
"name": "Test",
"attributes": {
"name": {
"firstname": "max",
"lastname": "mustermann"
},
"anboolen": false,
"anNumber": 1,
"anString": "Test"
}
}
]
The dictionary "attributes" is always an dictionary but the content inside could be everything.
for the container of results I already created an struct and using JSONDecoder to decode, but now I have the issue with the attributes part.
Can anyone help me with this issue?
Thanks in advance!
Post not yet marked as solved
Our app needs to scan QR codes (or a similar mechanism) to populate it with content the user wants to see.
Is there any update on QR code scanning availability on this platform? I asked this before, but never got any feedback.
I know that there is no way to access the camera (which is an issue in itself), but at least the system could provide an API to scan codes.
(It would be also cool if we were able to use the same codes Vision Pro uses for detecting the Zeiss glasses, as long as we could create these via server-side JavaScript code.)
Post not yet marked as solved
I created Keyboard extension and calling an api in it. Api is successfully called when i run the extension on iOS Simulator’s. But when i run the extension on iOS device Extension in loaded successfully but Api call is getting failed with error mentioned below.
2024-05-10 16:23:44.931827+0500 CustomKeyboardExtention[4073:48324] dnssd_clientstub ConnectToServer: connect() failed path:/var/run/mDNSResponder Socket:11 Err:-1 Errno:1 Operation not permitted
2024-05-10 16:23:44.932654+0500 CustomKeyboardExtention[4073:48324] [connection] nw_resolver_create_dns_service_locked [C1] DNSServiceCreateDelegateConnection failed: ServiceNotRunning(-65563)
2024-05-10 16:23:44.935914+0500 CustomKeyboardExtention[4073:48324] Connection 1: received failure notification
2024-05-10 16:23:44.936849+0500 CustomKeyboardExtention[4073:48324] Connection 1: failed to connect 10:-72000, reason -1
2024-05-10 16:23:44.937747+0500 CustomKeyboardExtention[4073:48324] Connection 1: encountered error(10:-72000)
2024-05-10 16:23:44.942682+0500 CustomKeyboardExtention[4073:48324] Task .<1> HTTP load failed, 0/0 bytes (error code: -1003 [10:-72000])
2024-05-10 16:23:44.949787+0500 CustomKeyboardExtention[4073:48324] Task .<1> finished with error [-1003] Error Domain=NSURLErrorDomain Code=-1003 "A server with the specified hostname could not be found." UserInfo={_kCFStreamErrorCodeKey=-72000, NSUnderlyingError=0x283aa35a0 {Error Domain=kCFErrorDomainCFNetwork Code=-1003 "(null)" UserInfo={_NSURLErrorNWPathKey=satisfied (Path is satisfied), interface: en0, ipv4, dns, _kCFStreamErrorCodeKey=-72000, _kCFStreamErrorDomainKey=10}}, _NSURLErrorFailingURLSessionTaskErrorKey=LocalDataTask .<1>, _NSURLErrorRelatedURLSessionTaskErrorKey=(
"LocalDataTask .<1>"
), NSLocalizedDescription=A server with the specified hostname could not be found., NSErrorFailingURLStringKey=https://chatbotsf-vzt2zxsi7q-uc.a.run.app/chatbot/, NSErrorFailingURLKey=https://chatbotsf-vzt2zxsi7q-uc.a.run.app/chatbot/, _kCFStreamErrorDomainKey=10}
Error fetching data: URLSessionTask failed with error: A server with the specified hostname could not be found.
Post not yet marked as solved
Hi,
I'm looking at being able to set a display colour profile via terminal. I know apps such as SwitchResX are able to change this but i can't figure out how and if it is possible to switch via a terminal command or via a script.
This here is what i would like to change.
I have googled about and searched through preference files but can't find anything.
Any help is much apreciated.
Thanks,
James
Post not yet marked as solved
By Implementing the TipKit framework in the AppKit Mac OS application, we were unable to close the popover when we clicked on the cross icon presented in TipNSPopover view.
And any clues about how to implement the TipNSPopover on Handover of NScollectionview ?. When the mouse enters any of the collection view cells, I have to present the TipNSpopover view.
Please share your input and thoughts.
Post not yet marked as solved
Xcode 15 introduced official support for static frameworks.
docs here
This is presumably because there's quite a bit over overlap with the mergeable libraries feature.
Static frameworks potentially give developers a nice option for bundling resources with a static library. This was previously only really viable if you explicitly packaged up a .bundle with your .a (static library) which could be cumbersome for both the creator and consumer of a library. Or you explicitly copied your framework resources into your main app binary when building your app.
The release notes for Xcode 15 state:
Embedding a static framework using a Copy Files build phase now removes the static archive from the framework when it is embedded in the target bundle.
When inspecting the app target on disk this appears to be the case. In fact the behaviour is the same as with a mergable in release mode whereby a "stub" binary exists with no symbols.
The release notes also state:
The COPY_RESOURCES_FROM_STATIC_FRAMEWORKS build setting, previously used in the legacy build system to extract and copy the resources from a static framework to the target bundle, no longer has any effect with the new build system as the entire framework is copied instead
This also appears to be the case when inspecting the files on disk as the frameworks appear to be present in the main app with their resources.
So far so good. The issue arises when trying to access the bundle associated with this framework. The documentation doesn't mention any special access requirements to it's assumed that standard bundle access APIs should work.
Using a class
let bundle = Bundle(for: InfoCoreMain.self)
This returns the main application bundle and therefore fails to find the correct asset. This can be rationalised by the fact that the InfoCoreMain class does now actually exist within the main app target binary due to being statically linked. It's worth noting however, that mergable libraries in release mode do seem to work in this way and can resolve the bundle fine*.
Using an explicit bundle identifier
let bundle = Bundle(identifier: "***.***.InfoCore")
Using an explicit bundle identifier returns nil even though we can see the framework on disk.
Using a path
Using a path to access the framework also doesn't work.
if let bundlePath = Bundle.main.path(forResource: "InfoCore", ofType: "framework") {
let bundle = Bundle(path: bundlePath)
// Now you can access resources in the framework bundle
} else {
// Framework bundle not found
}
All of the above is the same behaviour for release and debug builds.
I have tried this on Xcode 15.2 and 15.3
*Mergeable libraries do seem to have issues in debug mode. See this forum post.
https://forums.developer.apple.com/forums/thread/749818
Post not yet marked as solved
Because it may be quicker to ask: with a TPP, readData() gets a data size of 0 if the process has finished writing to the network. However, there seems to be no way to find out if it has finished reading from the network, other than to do a .write() and see if you get an error. (I filed a FB about this, for whatever that's worth.)
Since the API is flow-based, not socket, it's not possible to tell if the app has set its own timeout. Or exited. So one question I have is: if I do flow.write(Data(count:0)) -- is that a possible way to determine if it's still around? Or will it be interpreted as read(2) returning 0?
(Putting this in for testing is difficult, but not impossible -- as I said, this might be the quickest way to find out.)
Post not yet marked as solved
Hello,
We have an iOS application (navigation/mobility app) that we need to have it stay connected to TCP server even app is in background.
We tried disabling screen lock. We tried having location permission as "always". But it is not consistent. Usually, after 15 minutes, TCP connection is disconnected. We are unable to run code on app's side if it is in the background.
Our other workaround option is similar to WhatsApp or what every other companies / our rivals in the market do. Have a VOIP feature, use voip notification to wake up the app. But we really don't want to do that sort of thing.
Any feedback and any ideas are welcomed.
Thanks.
Post not yet marked as solved
Cannot assign a device for operation encoder/down1/downs_0/conv1/weight/Initializer/random_uniform/RandomUniform: Could not satisfy explicit device specification '' because the node {{colocation_node encoder/down1/downs_0/conv1/weight/Initializer/random_uniform/RandomUniform}} was colocated with a group of nodes that required incompatible device '/device:GPU:0'. All available devices [/job:localhost/replica:0/task:0/device:CPU:0, /job:localhost/replica:0/task:0/device:GPU:0].
Colocation Debug Info:
Colocation group had the following types and supported devices:
Root Member(assigned_device_name_index_=-1 requested_device_name_='/device:GPU:0' assigned_device_name_='' resource_device_name_='/device:GPU:0' supported_device_types_=[CPU] possible_devices_=[]
Identity: GPU CPU
Mul: GPU CPU
AddV2: GPU CPU
Sub: GPU CPU
RandomUniform: GPU CPU
Assign: CPU
VariableV2: GPU CPU
Const: GPU CPU
Post not yet marked as solved
React-native 0.73.6, Xcode 14.2, CocoaAsyncSocket 7.6.5
`ld: warning: directory not found for option '-L<Multiple'
ld: warning: directory not found for option '-F/Users/mr9q2/Library/Developer/Xcode/DerivedData/eduhookuser-fmwtqgvpalkgsmeiayqpwllwrscp/Build/Intermediates.noindex/ArchiveIntermediates/eduhookuser/BuildProductsPath/Release-iphoneos/XCFrameworkIntermediates/hermes-engine/Pre-built'
ld: library not found for -lCocoaAsyncSocket
clang: error: linker command failed with exit code 1 (use -v to see invocation)
Post not yet marked as solved
Hello everyone, I looked at various methods how to Unit/UITest SwiftData but I couldn't find something simple. Is it even possible to test SwiftData? Does someone found a solution for that?
Post not yet marked as solved
Recently I bought a new iPhone 14 Max Pro with a iOS 17 Beta release. While updating the phone with a cloud backup from my old iPhone 7 Plus the latest software (iOS17.5) has been installed on the phone. Now, every time I use my new phone the following message appears:
A new iOS-Update is available. Please update from iOS 17 Beta.
Unfortunately I can't do this because the menu "Settings", "Common Settings", "Software updates" shows that I've already installed the latest version. The message is "17.5 - Your iOS is at the latest release".
I've already tried to set my phone to the factory settings and several other steps like disabling Beta-Updates didn't work.
What can I do?
By the way: I'm not an Apple professional I'm a standard user but the standard Apple Support told me they can not help me but to reach out to you guys.
Post not yet marked as solved
xcode15.3, ios 17.4SDK VPN NEPacketTunnelProvider, After successful socket listen local ip 0.0.0.0, data packets cannot be received in release mode, but can be received in debug mode.This bug has been bothering me for a few days. Please help me. Thank you very much.
In networkExtension code:
... let ip4Set = ...
ip4Set.includedRoutes = [NEIPv4Route.default()]
...
func readDevicePackets(){
...
packetFlow.readPacketObjects { (packetList) in
... let sendPacketList: [NEPacket] = changePacket(packetList)
... packetFlow.writePacketObjects(sendPacketList)
readDevicePackets()
}
Post not yet marked as solved
In larger scenes, I need to record motion trajectories. RoomCaptureSession always starts from (0,0,0), and I use the last tracked point as the offset value to connect multiple trajectory points, just like StructureBuilder merging models
But when StructureBuilder merged, it eliminated some of the models, which would make the trajectory points I saved lose accuracy, and I cannot know how much scene size was specifically eliminated between them
Is there any way you can help me?
Post not yet marked as solved
I want to implement in-app purchases for my Mac Safari web extension.
I can think of two ways:
Draw the payment UI in an extension web page, and send a message to the native extension app to call StoreKit code.
Open the container app from an extension web page, where the app draws the payment UI.
I couldn't make #1 work with either
StoreKit 2, which is async, and context.completeRequest(returningItems:) doesn't want to be called in a Task, saying context is not sendable)
or StoreKit 1, where calling context.completeRequest(returningItems:) in paymentQueue(_:updatedTransactions:) for some reason doesn't return a response to the extension's web page.
I couldn't make #2 work because I couldn't find a way to open the container app from the web extension. I registered a custom URL for my container app, but context.open that url does nothing.
Web extensions that use IAP with #2 are available on the Mac app store, so it must be possible, could anyone shed some light on how to open the container app and pass the purchased info to the extension web page even if the container app is not open?
Thanks in advance.