Post not yet marked as solved
I created Keyboard extension and calling an api in it. Api is successfully called when i run the extension on iOS Simulator’s. But when i run the extension on iOS device Extension in loaded successfully but Api call is getting failed with error mentioned below.
2024-05-10 16:23:44.931827+0500 CustomKeyboardExtention[4073:48324] dnssd_clientstub ConnectToServer: connect() failed path:/var/run/mDNSResponder Socket:11 Err:-1 Errno:1 Operation not permitted
2024-05-10 16:23:44.932654+0500 CustomKeyboardExtention[4073:48324] [connection] nw_resolver_create_dns_service_locked [C1] DNSServiceCreateDelegateConnection failed: ServiceNotRunning(-65563)
2024-05-10 16:23:44.935914+0500 CustomKeyboardExtention[4073:48324] Connection 1: received failure notification
2024-05-10 16:23:44.936849+0500 CustomKeyboardExtention[4073:48324] Connection 1: failed to connect 10:-72000, reason -1
2024-05-10 16:23:44.937747+0500 CustomKeyboardExtention[4073:48324] Connection 1: encountered error(10:-72000)
2024-05-10 16:23:44.942682+0500 CustomKeyboardExtention[4073:48324] Task .<1> HTTP load failed, 0/0 bytes (error code: -1003 [10:-72000])
2024-05-10 16:23:44.949787+0500 CustomKeyboardExtention[4073:48324] Task .<1> finished with error [-1003] Error Domain=NSURLErrorDomain Code=-1003 "A server with the specified hostname could not be found." UserInfo={_kCFStreamErrorCodeKey=-72000, NSUnderlyingError=0x283aa35a0 {Error Domain=kCFErrorDomainCFNetwork Code=-1003 "(null)" UserInfo={_NSURLErrorNWPathKey=satisfied (Path is satisfied), interface: en0, ipv4, dns, _kCFStreamErrorCodeKey=-72000, _kCFStreamErrorDomainKey=10}}, _NSURLErrorFailingURLSessionTaskErrorKey=LocalDataTask .<1>, _NSURLErrorRelatedURLSessionTaskErrorKey=(
"LocalDataTask .<1>"
), NSLocalizedDescription=A server with the specified hostname could not be found., NSErrorFailingURLStringKey=https://chatbotsf-vzt2zxsi7q-uc.a.run.app/chatbot/, NSErrorFailingURLKey=https://chatbotsf-vzt2zxsi7q-uc.a.run.app/chatbot/, _kCFStreamErrorDomainKey=10}
Error fetching data: URLSessionTask failed with error: A server with the specified hostname could not be found.
Post not yet marked as solved
Hi,
I'm looking at being able to set a display colour profile via terminal. I know apps such as SwitchResX are able to change this but i can't figure out how and if it is possible to switch via a terminal command or via a script.
This here is what i would like to change.
I have googled about and searched through preference files but can't find anything.
Any help is much apreciated.
Thanks,
James
Post not yet marked as solved
By Implementing the TipKit framework in the AppKit Mac OS application, we were unable to close the popover when we clicked on the cross icon presented in TipNSPopover view.
And any clues about how to implement the TipNSPopover on Handover of NScollectionview ?. When the mouse enters any of the collection view cells, I have to present the TipNSpopover view.
Please share your input and thoughts.
Post not yet marked as solved
Xcode 15 introduced official support for static frameworks.
docs here
This is presumably because there's quite a bit over overlap with the mergeable libraries feature.
Static frameworks potentially give developers a nice option for bundling resources with a static library. This was previously only really viable if you explicitly packaged up a .bundle with your .a (static library) which could be cumbersome for both the creator and consumer of a library. Or you explicitly copied your framework resources into your main app binary when building your app.
The release notes for Xcode 15 state:
Embedding a static framework using a Copy Files build phase now removes the static archive from the framework when it is embedded in the target bundle.
When inspecting the app target on disk this appears to be the case. In fact the behaviour is the same as with a mergable in release mode whereby a "stub" binary exists with no symbols.
The release notes also state:
The COPY_RESOURCES_FROM_STATIC_FRAMEWORKS build setting, previously used in the legacy build system to extract and copy the resources from a static framework to the target bundle, no longer has any effect with the new build system as the entire framework is copied instead
This also appears to be the case when inspecting the files on disk as the frameworks appear to be present in the main app with their resources.
So far so good. The issue arises when trying to access the bundle associated with this framework. The documentation doesn't mention any special access requirements to it's assumed that standard bundle access APIs should work.
Using a class
let bundle = Bundle(for: InfoCoreMain.self)
This returns the main application bundle and therefore fails to find the correct asset. This can be rationalised by the fact that the InfoCoreMain class does now actually exist within the main app target binary due to being statically linked. It's worth noting however, that mergable libraries in release mode do seem to work in this way and can resolve the bundle fine*.
Using an explicit bundle identifier
let bundle = Bundle(identifier: "***.***.InfoCore")
Using an explicit bundle identifier returns nil even though we can see the framework on disk.
Using a path
Using a path to access the framework also doesn't work.
if let bundlePath = Bundle.main.path(forResource: "InfoCore", ofType: "framework") {
let bundle = Bundle(path: bundlePath)
// Now you can access resources in the framework bundle
} else {
// Framework bundle not found
}
All of the above is the same behaviour for release and debug builds.
I have tried this on Xcode 15.2 and 15.3
*Mergeable libraries do seem to have issues in debug mode. See this forum post.
https://forums.developer.apple.com/forums/thread/749818
Post not yet marked as solved
Because it may be quicker to ask: with a TPP, readData() gets a data size of 0 if the process has finished writing to the network. However, there seems to be no way to find out if it has finished reading from the network, other than to do a .write() and see if you get an error. (I filed a FB about this, for whatever that's worth.)
Since the API is flow-based, not socket, it's not possible to tell if the app has set its own timeout. Or exited. So one question I have is: if I do flow.write(Data(count:0)) -- is that a possible way to determine if it's still around? Or will it be interpreted as read(2) returning 0?
(Putting this in for testing is difficult, but not impossible -- as I said, this might be the quickest way to find out.)
Post not yet marked as solved
Hello,
We have an iOS application (navigation/mobility app) that we need to have it stay connected to TCP server even app is in background.
We tried disabling screen lock. We tried having location permission as "always". But it is not consistent. Usually, after 15 minutes, TCP connection is disconnected. We are unable to run code on app's side if it is in the background.
Our other workaround option is similar to WhatsApp or what every other companies / our rivals in the market do. Have a VOIP feature, use voip notification to wake up the app. But we really don't want to do that sort of thing.
Any feedback and any ideas are welcomed.
Thanks.
Post not yet marked as solved
Cannot assign a device for operation encoder/down1/downs_0/conv1/weight/Initializer/random_uniform/RandomUniform: Could not satisfy explicit device specification '' because the node {{colocation_node encoder/down1/downs_0/conv1/weight/Initializer/random_uniform/RandomUniform}} was colocated with a group of nodes that required incompatible device '/device:GPU:0'. All available devices [/job:localhost/replica:0/task:0/device:CPU:0, /job:localhost/replica:0/task:0/device:GPU:0].
Colocation Debug Info:
Colocation group had the following types and supported devices:
Root Member(assigned_device_name_index_=-1 requested_device_name_='/device:GPU:0' assigned_device_name_='' resource_device_name_='/device:GPU:0' supported_device_types_=[CPU] possible_devices_=[]
Identity: GPU CPU
Mul: GPU CPU
AddV2: GPU CPU
Sub: GPU CPU
RandomUniform: GPU CPU
Assign: CPU
VariableV2: GPU CPU
Const: GPU CPU
Post not yet marked as solved
React-native 0.73.6, Xcode 14.2, CocoaAsyncSocket 7.6.5
`ld: warning: directory not found for option '-L<Multiple'
ld: warning: directory not found for option '-F/Users/mr9q2/Library/Developer/Xcode/DerivedData/eduhookuser-fmwtqgvpalkgsmeiayqpwllwrscp/Build/Intermediates.noindex/ArchiveIntermediates/eduhookuser/BuildProductsPath/Release-iphoneos/XCFrameworkIntermediates/hermes-engine/Pre-built'
ld: library not found for -lCocoaAsyncSocket
clang: error: linker command failed with exit code 1 (use -v to see invocation)
Post not yet marked as solved
Hello everyone, I looked at various methods how to Unit/UITest SwiftData but I couldn't find something simple. Is it even possible to test SwiftData? Does someone found a solution for that?
Post not yet marked as solved
Recently I bought a new iPhone 14 Max Pro with a iOS 17 Beta release. While updating the phone with a cloud backup from my old iPhone 7 Plus the latest software (iOS17.5) has been installed on the phone. Now, every time I use my new phone the following message appears:
A new iOS-Update is available. Please update from iOS 17 Beta.
Unfortunately I can't do this because the menu "Settings", "Common Settings", "Software updates" shows that I've already installed the latest version. The message is "17.5 - Your iOS is at the latest release".
I've already tried to set my phone to the factory settings and several other steps like disabling Beta-Updates didn't work.
What can I do?
By the way: I'm not an Apple professional I'm a standard user but the standard Apple Support told me they can not help me but to reach out to you guys.
Post not yet marked as solved
xcode15.3, ios 17.4SDK VPN NEPacketTunnelProvider, After successful socket listen local ip 0.0.0.0, data packets cannot be received in release mode, but can be received in debug mode.This bug has been bothering me for a few days. Please help me. Thank you very much.
In networkExtension code:
... let ip4Set = ...
ip4Set.includedRoutes = [NEIPv4Route.default()]
...
func readDevicePackets(){
...
packetFlow.readPacketObjects { (packetList) in
... let sendPacketList: [NEPacket] = changePacket(packetList)
... packetFlow.writePacketObjects(sendPacketList)
readDevicePackets()
}
Post not yet marked as solved
In larger scenes, I need to record motion trajectories. RoomCaptureSession always starts from (0,0,0), and I use the last tracked point as the offset value to connect multiple trajectory points, just like StructureBuilder merging models
But when StructureBuilder merged, it eliminated some of the models, which would make the trajectory points I saved lose accuracy, and I cannot know how much scene size was specifically eliminated between them
Is there any way you can help me?
Post not yet marked as solved
I want to implement in-app purchases for my Mac Safari web extension.
I can think of two ways:
Draw the payment UI in an extension web page, and send a message to the native extension app to call StoreKit code.
Open the container app from an extension web page, where the app draws the payment UI.
I couldn't make #1 work with either
StoreKit 2, which is async, and context.completeRequest(returningItems:) doesn't want to be called in a Task, saying context is not sendable)
or StoreKit 1, where calling context.completeRequest(returningItems:) in paymentQueue(_:updatedTransactions:) for some reason doesn't return a response to the extension's web page.
I couldn't make #2 work because I couldn't find a way to open the container app from the web extension. I registered a custom URL for my container app, but context.open that url does nothing.
Web extensions that use IAP with #2 are available on the Mac app store, so it must be possible, could anyone shed some light on how to open the container app and pass the purchased info to the extension web page even if the container app is not open?
Thanks in advance.
Post not yet marked as solved
I schedule a local notification to remind me to check in at work at 8 am if I am not already checked in, the code is working fine when app is in foreground, but when I kill the app, it alway show alert no matter if I already checked in or not.
func userNotificationCenter(_ center: UNUserNotificationCenter, willPresent notification: UNNotification, withCompletionHandler completionHandler: @escaping (UNNotificationPresentationOptions) -> Void) {
let isCheckedIn = AppManager.shared.isCheckedIn()
if isCheckedIn {
completionHandler([])
} else {
completionHandler([.list, .sound, .banner])
}
}
Post not yet marked as solved
Hello everyone
My goal is to create Apple's activity ring sparkle effect. So I found Paul Hudson's Vortex library. There is already a sparkle effect, but I don't know how to modify it to achieve my goal. Because I'm pretty new to SwiftUI animations. Does anyone have any idea how I could do this?
Vortex project: https://github.com/twostraws/Vortex
Post not yet marked as solved
Searching for nearby POIs using MKLocalPointsOfInterestRequest has been unsuccessful with error Error Domain=MKErrorDomain Code=5 "(null)" UserInfo={MKErrorGEOError=-10}. Is there any solution?
Post not yet marked as solved
Before iOS 17, CTFrameGetLines(ctFrame) returns exact number of lines it will displayed on the screen. However after iOS 17.2.x, under some unknown condition, it returns less CTLines. It's easy to reproduce:
let formattedString = NSMutableAttributedString()
formattedString.append(.init(string: "你", attributes: [.font: UIFont.boldSystemFont(ofSize: 14)]))
formattedString.append(.init(string: "\n\n\n\n\n\n好\n"))
let ctSetter = CTFramesetterCreateWithAttributedString(formattedString as CFAttributedString)
let rect = CGRect(x: 0, y: 0, width: 100, height: 1000)
let bezierPath = UIBezierPath(rect: rect)
let ctFrame = CTFramesetterCreateFrame(ctSetter, CFRangeMake(0, formattedString.length), bezierPath.cgPath, nil)
let ctLines = CTFrameGetLines(ctFrame)
print("CTLine count: \(CFArrayGetCount(ctLines))")
The test code above should print CTLine count: 7, but actually it returns 4. One weird CTLine is like:
- 1 : <CTLine: 0x3031e0780>{run count = 1, string range = (2, 3), width = 0, A/D/L = 9.24023/2.75977/0, glyph count = 3, runs = (
<CTRun: 0x10173ec50>{string range = (2, 3), string = "\n\n\n", attributes = {
NSFont = "<UICTFont: 0x101728800> font-family: \"Helvetica\"; font-weight: normal; font-style: normal; font-size: 12.00pt";
}}
)
}
never met this issue before, is it a bug or just new feature...
Post not yet marked as solved
It gives me error for "import SplineRuntime". It says no such module even if I add the packagies dependencies from github. I tried to rebuild and clean everything but it still gives me this error.
Post not yet marked as solved
Hi All,
Finder is caching the old application name and not showing the new application.
I am deploying my iPad app to M1 Mac by generating a package file. In the newer version of this application, I have changed my application name and deployed the application from backend to user machines.
Eventhough application is deployed successfully, the application name still remains the old. I went through the forum and tried the reset the finder cache and launcher service caches, but still the new application name is not coming.
But when I uninstall and reinstall the application it is showing the new application name.
Can someone suggest a way to reset this using script, as we are deploying the application from backend, we dont have direct access to the client machines
Thanks
Ranga
Post not yet marked as solved
I'm defining a typealias for a set, and then creating an extension for the new typealias.
When I do this, I'm getting an odd syntax error. Any/all guidance appreciated.
typealias IntSet = Set<Int>
extension IntSet {
func aFunction() -> Set<String> {
let array: [String] = self.map { "\($0)" }
return Set(array)
}
}
At the return line, I get the following syntax error: Cannot convert return expression of type 'Set<Int>' to return type 'Set<String>'
Even if I replace the return line with the following, I get the same compile error
return Set("array")